• Rezultati Niso Bili Najdeni

DIPLOMSKO DELO

N/A
N/A
Protected

Academic year: 2022

Share "DIPLOMSKO DELO"

Copied!
64
0
0

Celotno besedilo

(1)

F

AKULTETA ZA KEMIJO IN KEMIJSKO TEHNOLOGIJO

DIPLOMSKO DELO

Filip Džeroski

Ljubljana, 2022

(2)
(3)

F

AKULTETA ZA KEMIJO IN KEMIJSKO TEHNOLOGIJO

Univerzitetni študijski program 1. stopnje KEMIJA

Selektivne Michaelove adicije brez topil

DIPLOMSKO DELO

Filip Džeroski

M

ENTOR

: prof. dr. Marjan Jereb

Ljubljana, 2022

(4)
(5)

IZJAVA O AVTORSTVU

diplomskega dela

Spodaj podpisani Filip Džeroski sem avtor diplomskega dela z naslovom: Selektivne Michaelove adicije brez topil.

S svojim podpisom zagotavljam, da:

 je diplomsko delo rezultat mojega raziskovalnega dela pod mentorstvom prof.

dr. Marjana Jereba;

 sem poskrbel, da so dela in mnenja drugih avtorjev, ki jih uporabljam v

predloženem diplomskem delu, navedena oziroma citirana v skladu z navodili;

 se zavedam, da je plagiatorstvo, v katerem so tuje misli oziroma ideje

predstavljene kot moje lastne, kaznivo po zakonu (Zakon o avtorski in sorodnih pravicah – uradno prečiščeno besedilo (ZASP-UPB3) (Ur. list RS, št. 16/2007);

 sem poskrbel za slovnično in oblikovno korektnost diplomskega dela;

 je elektronska oblika diplomskega dela identična tiskani obliki diplomskega dela.

V Ljubljani, 14.1.2022 Podpis avtorja:

(6)
(7)
(8)
(9)

Za spodbudo, strokovne nasvete in vodenje pri izdelavi ter pisanju diplomske naloge se iskreno zahvaljujem mentorju prof. dr. Marjanu Jerebu. Za pomoč in napotke pri laboratorijskem delu se lepo zahvaljujem kolegici Tanji Topič.

Za podporo pri študiju bi se rad zahvalil mojemu profesorju tutorju prof. dr. Antonu Medenu, mojemu študentu tutorju Martinu Rafaelu Gulinu ter prijateljem Ivani Podlipnik, Katji Vodlan in Žanu Tomšiču.

Za strokovne nasvete gre zahvala še Tini Kosjek in Žigi Tkalcu z Instituta Jožef Stefan.

Velika zahvala gre tudi mojim staršem in sestri, ki so me vsa leta študija spodbujali, mi stali ob strani in niso obupali nad mano. Za prijateljsko podporo med študijem in izdelavo diplomskega dela pa se najlepše zahvaljujem Dominiku Dolinarju.

(10)
(11)

Povzetek: Pri svojem diplomskem delu sem se osredotočil na Michaelove adicije v prisotnosti in odsotnosti topil. Izvedel sem predvsem adicije aktiviranih metilenskih spojin (Michaelovi donorji) na tako α,β-nenasičene ketone kot tudi nitroalkene (Michaelovi akceptorji), in sicer v prisotnosti katalizatorjev LiClO4 in Et3N pri sobni temperaturi ter brez prisotnosti topil. Prav tako sem sintetiziral derivat rodanina v prisotnosti vode, a brez dodanih katalizatorjev. Reakcije sem najprej izvedel v manjšem merilu in jih kasneje izvedel še v večjem merilu, če so bile v manjšem merilu uspešne.

Produkte reakcij v manjšem merilu sem izoliral z ekstrakcijo in destilacijo, pri reakcijah v večjem merilu pa sem produkte očistil s prekristalizacijo. Izkoristki reakcij v manjšem merilu so bili odlični, medtem ko so bili izkoristki pri večjem merilu slabi ali kvečjemu povprečni. Na koncu sem produkte analiziral z uporabo 1H NMR spektrov, ki sem jih posnel v CDCl3 pri 300 MHz.

Ključne besede: Michaelova adicija, brez topil, zelena kemija, aktivirane metilenske spojine

Solvent-free selective Michael additions

Abstract: In the thesis, I focused on Michael additions in solution or under solvent- free conditions. I mostly carried out additions of activated methylene compounds (Michael donors) onto α,β-unsaturated ketone and nitroalkenes (Michael acceptors) in the presence of the LiClO4/Et3N catalyst at room temperature under solvent-free conditions. I also synthesized a rhodanine derivative in water under catalyst-free conditions. All reactions were first carried out on a smaller scale and later - if successful on the smaller scale - also on a larger scale. I isolated the small-scale products with extraction and distillation, while purification of products on a larger scale was performed by crystallization. Reactions on a smaller scale gave products in excellent yields, while large-scale reaction yields varied from poor to average. I analyzed my products using

1H NMR spectra recorded in CDCl3 at 300 MHz.

Keywords: Michael addition, solvent-free, green chemistry, activated methylene compounds

(12)
(13)

Kazalo

1 Uvod ... 1

1.1 Michaelove adicije ... 1

1.1.1 Uvod v Michaelove adicije ... 1

1.1.2 Mehanizem Michaelove adicije ... 2

1.1.3 Selektivnost pri Michaelovih adicijah ... 2

1.1.4 Primeri Michaelovih adicij brez topil ... 3

1.1.5 Pomanjkljivosti in potencial Michaelovih adicij ... 4

1.1.6 Izbrani Michaelovi donorji – aktivirane metilenske spojine ... 5

1.1.7 Izbrani Michaelovi donorji ... 6

1.2 Reakcije brez topil ... 7

1.2.1 Problematika topil ... 7

1.2.2 Opredelitev reakcij brez topil ... 7

1.2.3 Alternativna topila ... 8

1.2.4 Voda kot zeleno topilo ... 8

1.3 Zelena kemija ... 8

1.3.1 Osnove zelene kemije ... 8

1.3.2 Dvanajst principov zelene kemije ... 9

1.3.3 Atomska ekonomija in E-faktor ... 10

2 Namen dela ... 11

3 Eksperimentalni del ... 13

3.1 Uporabljene kemikalije... 13

3.2 Uporabljene aparature... 13

3.3 Sintezni postopki za izvedene reakcije ... 13

3.3.1 Sinteza (3-benzil-4-okso-2-tioksotiazolidin-5-il)ocetne kisline ... 13

3.3.2 Splošni postopek za Michaelove adicije v manjšem merilu ... 14

3.3.3 Splošni postopek za Michaelove adicije v večjem merilu ... 14

3.4 Reakcije v manjšem merilu ... 15

(14)

3.4.1 Sinteza (3-benzil-4-okso-2-tioksotiazolidin-5-il)ocetne kisline (spojina 5) 15

3.4.2 Sinteza etil 2-acetil-5-okso-3,5-difenilpentanoata (spojina 10) ... 16

3.4.3 Sinteza etil 2-acetil-4-nitro-3-fenilbutanoata (spojina 12) ... 17

3.4.4 Sinteza dimetil 2-(2-nitro-1-feniletil)malonata (spojina 14) ... 18

3.4.5 Sinteza dimetil 2-(3-okso-1,3-difenilpropil)malonata (spojina 15) ... 19

3.4.6 Sinteza metil 2-ciano-4-nitro-3-fenilbutanoata (spojina 17) ... 20

3.4.7 Sinteza metil 2-ciano-5-okso-3,5-difenilpentanoata (spojina 18) ... 21

3.4.8 Sinteza metil 2-acetil-4-nitro-3-fenilbutanoata (spojina 20) ... 22

3.4.9 Sinteza metil 2-acetil-5-okso-3,5-difenilpentanoata (spojina 21) ... 23

3.5 Reakcije v večjem merilu ... 24

3.5.1 Sinteza etil 2-acetil-5-okso-3,5-difenilpentanoata (spojina 10) ... 24

3.5.2 Sinteza dimetil 2-(2-nitro-1-feniletil)malonata (spojina 14) ... 25

3.5.3 Sinteza dimetil 2-(3-okso-1,3-difenilpropil)malonata (spojina 15) ... 26

3.5.4 Sinteza metil 2-acetil-4-nitro-3-fenilbutanoata (spojina 20) ... 27

3.5.5 Sinteza metil 2-acetil-5-okso-3,5-difenilpentanoata (spojina 21) ... 28

4 Rezultati in razprava ... 29

4.1 Spojina 5: (3-benzil-4-okso-2-tioksotiazolidin-5-il)ocetna kislina ... 31

4.2 Spojina 10: etil 2-acetil-5-okso-3,5-difenilpentanoat ... 31

4.3 Spojina 12: etil 2-acetil-4-nitro-3-fenilbutanoat ... 32

4.4 Spojina 14: dimetil 2-(2-nitro-1-feniletil)malonat ... 32

4.5 Spojina 15: dimetil 2-(3-okso-1,3-difenilpropil)malonat ... 32

4.6 Spojina 17: metil 2-ciano-4-nitro-3-fenilbutanoat ... 33

4.7 Spojina 18: metil 2-ciano-5-okso-3,5-difenilpentanoat ... 33

4.8 Spojina 20: metil 2-acetil-4-nitro-3-fenilbutanoat ... 33

4.9 Spojina 21: metil 2-acetil-5-okso-3,5-difenilpentanoat ... 34

5 Zaključek ... 35

6 Literatura ... 37

7 Priloge ... 43

7.1 P1: IR spekter etil 2-acetil-5-okso-3,5-difenilpentanoata ... 43

(15)

7.3 P3: IR spekter dimetil 2-(3-okso-1,3-difenilpropil)malonata ... 45

7.4 P4: IR spekter metil 2-acetil-4-nitro-3-fenilbutanoata ... 46

7.5 P5: IR spekter metil 2-acetil-5-okso-3,5-difenilpentanoata ... 47

Kazalo slik

Slika 1: Izvedba TLC za reakcije v večjem merilu. ... 14

Kazalo tabel

Tabela 1: Pregled vseh sintetiziranih produktov. ... 30

Kazalo shem

Shema 1: Sinteza (3-benzil-4-okso-2-tioksotiazolidin-5-il)ocetne kisline. ... 15

Shema 2: Sinteza etil 2-acetil-5-okso-3,5-difenilpentanoata. ... 16

Shema 3: Sinteza etil 2-acetil-4-nitro-3-fenilbutanoata. ... 17

Shema 4: Sinteza dimetil 2-(2-nitro-1-feniletil)malonata. ... 18

Shema 5: Sinteza dimetil 2-(3-okso-1,3-difenilpropil)malonata. ... 19

Shema 6: Sinteza metil 2-ciano-4-nitro-3-fenilbutanoata. ... 20

Shema 7: Sinteza metil 2-ciano-5-okso-3,5-difenilpentanoata. ... 21

Shema 8: Sinteza metil 2-acetil-4-nitro-3-fenilbutanoata. ... 22

Shema 9: Sinteza metil 2-acetil-5-okso-3,5-difenilpentanoata. ... 23

Shema 10: Sinteza etil 2-acetil-5-okso-3,5-difenilpentanoata (ponovljena Shema 2).. . 24

Shema 11: Sinteza dimetil 2-(2-nitro-1-feniletil)malonata (ponovljena Shema 4). ... 25

Shema 12: Sinteza dimetil 2-(3-okso-1,3-difenilpropil)malonata (Shema 5, krajši čas). ... 26

Shema 13: Sinteza metil 2-acetil-4-nitro-3-fenilbutanoata (Shema 8, daljši čas). ... 27 Shema 14: Sinteza metil 2-acetil-5-okso-3,5-difenilpentanoata (ponovljena Shema 9). 28

(16)
(17)

8YRG

0LFKDHORYHDGLFLMH

8YRGY0LFKDHORYHDGLFLMH

0LFKDHORYD DGLFLMD MH YUVWD QXNOHRILOQH NRQMXJDWLYQH DGLFLMH NMHU VH UHVRQDQþQR VWDELOL]LUDQNDUERDQLRQQSUHQRODWYHåHQDȕRJOMLNHOHNWURILOQHĮȕQHQDVLþHQHVSRMLQH

>@3RMHPNRQMXJDWLYQDDGLFLMDR]QDþXMHDGLFLMRQXNOHRILODQDȕRJOMLNRYDWRPDONHQD ]HOHNWURQSULYODþQRVNXSLQR>@5HDNFLMDMHGRELODLPHSRDPHULãNHPNHPLNX$UWKXUX 0LFKDHOX±NLMHWDNRQFHSWSUYLSUHGVWDYLOMDYQRVWLOHWD>@

7LSLþQRLPDMRY0LFKDHORYLKDGLFLMDKYORJRQXNOHRILODDNWLYLUDQHPHWLOHQVNHDOLPHWLQVNH VNXSLQH >@ QSU PDORQDWL ȕNHWRHVWUL DOL DONLO FLDQRDFHWDWL >@ PHGWHP NR YORJR HOHNWURILOD RELþDMQR RSUDYOMDMR ĮȕQHQDVLþHQH NDUERQLOQH VSRMLQH NHWRQL DOGHKLGL DOL HVWUL 0HG XVWUH]QH HOHNWURILOH XYUãþDPR WXGL QLWUR LQ FLDQRDONHQH VDM WXGL WL ODKNR DNWLYLUDMR GYRMQR DOL WURMQR YH] &±& ]D QXNOHRILOHQ QDSDG >@ 9 0LFKDHORYL DGLFLML VRGHOXMRþHPXQXNOHRILOXSUDYLPR0LFKDHORYGRQRUHOHNWURILOXSD0LFKDHORYDNFHSWRU

>@5HDNFLMRSRQDYDGLNDWDOL]LUDMRPRþQHED]HNRWQSU1D2(W1D2+.2+LQ%D2+

>@þHSUDYVHQDPHVWRPRþQLKED]XSRUDEOMDWXGLNRPELQDFLMD/HZLVRYHNLVOLQHLQãLENH ED]H>@1HNDWHUHWLSLþQH0LFKDHORYHDGLFLMHVR

x DGLFLMDPHWLOFLNORSHQWDQRQDQDPHWLODNULODW>@

x DGLFLMDGLHWLOPDORQDWDQDHWLODWURSDW>@LQ

x DGLFLMDDNULORQLWULODQDHWLOIHQLOFLDQRDFHWDW>@

(18)

F. Džeroski Selektivne Michaelove adicije brez topil

2

1.1.2 Mehanizem Michaelove adicije

Mehanizem Michaelove adicije je ponazorjen na primeru splošne adicije 1,3-dikarbonilne spojine na α,β-nenasičeno karbonilno spojino. R predstavlja npr. metilno skupino.

Proces lahko razdelimo na tri različne korake: v prvem koraku baza aktivira pronukleofil (Michaelov donor je označen z modro) z abstrakcijo protona, kar vodi v nastanek enolata [2, 11]. V drugem koraku pride do nukleofilnega napada enolatnega aniona na β-mesto α,β-nenasičene karbonilne spojine (Michaelov akceptor), ki je na shemi označena z rdečo.

Drugače povedano, poteče 1,4-nukleofilna oz. konjugativna adicija [12]. V tretjem koraku poteče adicija elektrofila (najpogosteje protona), ki ga prispeva protonirana baza, na nastali enolat akceptorja, elektrofil pa lahko prispeva tudi topilo. Kot rezultat dobimo 1,5-dikarbonilno spojino [2].

1.1.3 Selektivnost pri Michaelovih adicijah

Michaelova adicija načeloma poteče tako, da pride do konjugativne adicije na β-ogljikov atom (1,4-adicija). Namesto tega pa lahko pride do nezaželjene adicije na karbonilni ogljik (1,2-adicija). Selektivnost adicije je močno odvisna od vrste in narave substituenta na dvojni vezi C–C Michaelovega akceptorja [13] in od nukleofilnosti Michaelovega donorja. Z uporabo bolj bazičnih in reaktivnih (trdih) nukleofilov bo favorizirana 1,2- adicija, ker je karbonilni ogljikov atom (trd elektrofil) bolj elektrofilen od β-ogljikovega atoma. Če je nukleofil slabo izstopajoča skupina, potem je ta reakcija hkrati tudi ireverzibilna. Po drugi strani šibkejše baze favorizirajo 1,4-adicijo iz istega razloga (β- ogljikov atom je manj elektrofilen) in je v tem primeru 1,2-adicija bolj reverzibilna [6].

Cilj je torej favorizirati 1,4-adicijo, hkrati pa želimo doseči zadostno koncentracijo karboaniona. Donor mora biti šibka (konjugativna) baza, zato mora biti pronukleofil relativno kisel. Pri Michaelovih adicijah s katalitičnim dodatkom baze so zato najbolj učinkoviti donorji metilenske (ali metinske) skupine z dvema elektron-privlačnima skupinama (kot npr. malonati ali β-ketoestri [6]), ki lahko stabilizirata anion [11]. Na ta način nastali anionski adukt je bolj bazičen od nukleofilnega donorja, kar pomeni, da se bo preferenčno protoniral. Dodatna možnost je zmanjšanje reaktivnosti karbonilne spojine akceptorja (npr. dodatno substituiranje) [6].

(19)

3ULPHUL0LFKDHORYLKDGLFLMEUH]WRSLO

1DMEROM WLSLþHQ SULPHU 0LFKDHORYH DGLFLMH EUH] SULVRWQRVWL WRSLO MH SUYD 0LFKDHORYD DGLFLMDNLMRMH$UWKXU0LFKDHOSUHGVWDYLOOHWD,]YHGHOMHDGLFLMRGLHWLOPDORQDWDQD HWLOFLQDPDWYSULVRWQRVWL(W2+LQ1D2(WSULVREQLWHPSHUDWXULVKHPDVSRGDM3RYRG]D WRUHDNFLMRMHELODREMDYD&RQUDGDLQ.XWK]HLWDOHWD>@

9 LQGXVWULML MH UD]YRM NDWDOL]LUDQLK RNVD LQ D]D0LFKDHORYLK DGLFLM ]DåHOMHQ NHU VR DONRKROL LQ DPLQL SRFHQL VXURYLQH Y NHPLMVNL LQGXVWULML âWHYLOQL SRL]NXVL VR ELOL Y SUHWHNORVWLQHXVSHãQL]DUDGL]DKWHYQLKSRJRMHYYLVRNWODNUD]QDWRSLODLQDGLWLYL.RW DOWHUQDWLYD PRþQLP ED]LþQLP LQ GUXJDþH HNVWUHPQLP SRJRMHP VR *XQDQDWKDQ LQ VRGHODYFL>@L]YDMDOLRNVDLQD]D0LFKDHORYHDGLFLMHEUH]WRSLOLQVHJUHYDQMDLQVLFHUV NDWDOLWLþQLP GRGDWNRPW%X2. EODJL ED]LþQL SRJRML VKHPD VSRGDM 1D WD QDþLQ VR GRVHJOLLPSUHVLYQHL]NRULVWNHLQNRQYHU]LMHSRQHNRGFHOR

9LMDLNXPDULQ3LWFKXPDQL>@VWDSUDYWDNRUD]LVNRYDODDOWHUQDWLYHNPRþQLPED]LþQLP SRJRMHP 3UHGVWDYLOD VWD XVSHãQR 0LFKDHORYR DGLFLMR DNWLYQLK PHWLOHQVNLK VSRMLQ QD HQRQHREGRGDWNXNDWDOLWLþQHNROLþLQHKLGURWDOFLWDEUH]SULVRWQRVWWRSLOSULPHUMHSRGDQ QD VSRGQML VKHPL 1DPHVWR RELþDMQHJD VHJUHYDQMD VWD XSRUDELOD PLNURYDORYQR REVHYDQMH'RVHJODVWDGREUHL]NRULVWNHLQNUDMãLUHDNFLMVNLþDV

6DLGLLQVRGHODYFL>@VRSRURþDOLRXþLQNRYLWLLQVHOHNWLYQL0LFKDHORYLDGLFLMLDNWLYQLK PHWLOHQVNLKVSRMLQQDNDONRQHLQQLWURDONHQHEUH]WRSLOD]DUD]OLNRRGRELþDMQLKPRþQLK ED]VRGRGDOLNDWDOLWLþQRNROLþLQR/HZLVRYHNLVOLQH/L&O2LQãLENHED]H(W1SULPHUMH SRGDQQDVSRGQMLVKHPL2SD]LOLVRGDMHYSULPHUXUHDNFLMHEUH]WRSLO/HZLVRYDNLVORVW OLWLMHYHJD LRQD YLãMD NRW Y SULPHUX XSRUDEH RELþDMQHJD WRSLOD NDU MH RPRJRþLOR NUDMãL UHDNFLMVNLþDVPDQMãRSRUDERNDWDOL]DWRUMDLQEROMãHL]NRULVWNH

(20)

)'åHURVNL 6HOHNWLYQH0LFKDHORYHDGLFLMHEUH]WRSLO

<XLQVRGHODYFL>@SDVRXVSHãQRL]YHGOL0LFKDHORYHDGLFLMHGLNDUERQLOQLKVSRMLQ QDQLWURDONHQHEUH]WRSLOLQEUH]XSRUDEHNDWDOL]DWRUMHYSULVREQLWHPSHUDWXUL1DPHVWR WHJDVRUHDNWDQWH]PHãDOLLQ]POHOL]XSRUDERDGLWLYRYPHGGUXJLPNUHPHQþHYSHVHN NDUMHGDORELVWYHQREROMãHL]NRULVWNHNRWYSULPHUXXSRUDEHRELþDMQLKWRSLOQSU7+) +2LQDFHWRQ

3RPDQMNOMLYRVWLLQSRWHQFLDO0LFKDHORYLKDGLFLM

äDOLPDMR0LFKDHORYHDGLFLMHUHVQHSRPDQMNOMLYRVWLLQRPHMLWYH7DNHUHDNFLMHSRQDYDGL ]DKWHYDMRGROJUHDNFLMVNLþDVLQGDMHMRSURGXNWH]QL]NLPL]NRULVWNRP>@5HDNFLMDSRWHND SRGGUDVWLþQRED]LþQLPLSRJRML>@NDUSUHGVWDYOMDSUHFHMãQMRQHYDUQRVW]DRNROMH>@

KNUDWLSDSRJRVWRYRGLGRQHåHOHQLKVWUDQVNLKSURGXNWRYLQUHDNFLMQSUSROLPHUL]DFLMH YHþNUDWQHNRQGHQ]DFLMHLQSUHPHVWLWYH>@>@'RGDWQRRPHMLWHY0LFKDHORYLKDGLFLMY ED]LþQLKSRJRMLKSUHGVWDYOMDUHYHU]LELOQRVWVDPHUHDNFLMHUHWUR0LFKDHORYDDGLFLMDNDU SDODKNRPLQLPL]LUDPR]XSRUDERãLENLKED]QSU(W1LQUD]UHGþHQLKUD]WRSLQ>@

.OMXEYVHPXMH0LFKDHORYDDGLFLMDHQDQDMSRPHPEQHMãLKLQXSRUDEQLKPHWRGWYRUMHQMD

&±&YH]LYRUJDQVNLVLQWH]L>@LQMHHGHQRGJODYQLKQDþLQRYSULSUDYHGLNDUERQLOQLK VSRMLQ >@ 3ROHJ XþLQNRYLWRVWL VR 0LFKDHORYH DGLFLMH WXGL ]HOR SUHSURVWH LQ DWRPVNR HNRQRPLþQH>@+NUDWLLPDMRSRWHQFLDO]DãWHYLOQHLQGXVWULMVNHDSOLNDFLMH>@ãHSRVHEHM Y IDUPDFHYWVNL LQ DJURNHPLþQL LQGXVWULML >@ VDM VH ODKNR ]ODKND XSRUDEL ]D JUDGQMR IXQNFLRQDOL]LUDQLK RJOMLNRYLK RJURGLM >@ LQ WYRUER NOMXþQLK SUHNXU]RUMHY SRPHPEQLK QDUDYQLKSURGXNWRY>@QSUURGDQLQLQQMHJRYLGHULYDWL>@

5RGDQLQMHSHWþOHQVNDKHWHURFLNOLþQDVSRMLQDNLYVHEXMHWLD]ROLGLQVNLREURþ>@1HQFNL MHSUYLRGNULOURGDQLQOHWDNRMHL]YHGHOUHDNFLMRPHGDPRQLMHYLPWLRFLDQDWRPLQ NORURRFHWQRNLVOLQRYYRGL>@5RGDQLQLQQMHJRYHGHULYDWHRELþDMQRVLQWHWL]LUDPRQD GYD QDþLQD SUYL QDþLQ MH DGLFLMD L]RWLRFLDQDWD QD PHUNDSWRRFHWQR NLVOLQR LQ QDGDOMQMD NLVOLQVNDFLNOL]DFLMD'UXJLQDþLQMHUHDNFLMDLQVLWXSULSUDYOMHQLKGLWLRNDUEDPLGQLKNLVOLQ ] L]EUDQLPL HOHNWURILOL NRW VR QSU NORURRFHWQD NLVOLQD DOL NORURDFHWLO NORULG 9 åHOML SR L]YHGELUHDNFLMHYEROM]HOHQLKSRJRMLKVWD+DOLPHKMDQLLQ+RVVHLQNKDQ\UD]YLODVLQWH]R URGDQLQRYLK GHULYDWRY SR SULQFLSX 0LFKDHORYH DGLFLMH Y YRGL EUH] NDWDOL]DWRUMHY LQ GRGDWQLKWRSLOSULPHUQDVSRGQMLVKHPL>@

5RGDQLQ LQ QMHJRYL GHULYDWL VR ]QDQL SR VYRMLK ELRORãNLK LQ IDUPDNRORãNLK ODVWQRVWLK SUHGYVHP SD SR DQWLPLNUREQL DQWLYLUXVQL LQ DQWLWXPRUQL DNWLYQRVWL > @ 1HNDWHUL URGDQLQRYLGHULYDWLVHODKNRXSRUDEOMDMRNRWLQKLELWRUML]DUD]QHWDUþQHHQFLPHNRWVRQSU DOGR]DUHGXNWD]DDOLȕODNWDPD]DDOLSDNRWDQWLGLDEHWLþQDVUHGVWYD>@

(21)

,]EUDQL0LFKDHORYLGRQRUML±DNWLYLUDQHPHWLOHQVNHVSRMLQH

$NWLYLUDQHPHWLOHQVNHVSRMLQHVRVSRMLQHNLLPDMRQDPHWLOHQVNRVNXSLQR]REHKVWUDQL YH]DQL HOHNWURQSULYODþQL VNXSLQL QSU NDUERQLOQD DOL QLWULOQD VNXSLQD = XSRUDER ED]

ODKNRL]WDNãQLKVSRMLQGRELPRNDUERDQLRQHDOLSDHQRODWH]DWRVHSRJRVWRXSRUDEOMDMRY RUJDQVNLVLQWH]LQSUSUL.QRHYHQDJHORYLKNRQGHQ]DFLMDK>@.RWåHRPHQMHQRPHG WDNHVSRMLQHXYUãþDPRQSUȕNHWRHVWUHPDORQDWHLQDONLOFLDQRDFHWDWH>@

ȕNHWRHVWUL

ȕNHWRHVWULVRHVWULNLLPDMRQDȕRJOMLNRYHPDWRPXNDUERQLOQRVNXSLQRLQVSDGDMRYYUVWR GLNDUERQLOQLK VSRMLQ R] ȕGLNDUERQLOQLK VSRMLQ 6LQWHWL]LUD VH MLK ODKNR SUHNR

&ODLVHQRYH NRQGHQ]DFLMH HVWURY SUL NDWHUL SULGH GR WYRUEH &±& YH]L PHG GYHPD PROHNXODPDHVWUDYSULVRWQRVWLPRþQHED]H>@ȕNHWRHVWULVHYLQGXVWULMLXSRUDEOMDMRSUL VLQWH]LNRPSOHNVQLKQDUDYQLKSURGXNWRYNRWMHQSUSDNOLWDNVHO37;NLVHXSRUDEOMD]D ]GUDYOMHQMHUD]OLþQLKYUVWUDND>@

0DORQDWQLHVWUL

0DORQDWQLHVWULVRGHULYDWLPDORQVNHNLVOLQH,]UD]PDORQDWODKNRSRPHQLWXGLVRODOLDQLRQ PDORQVNHNLVOLQH3ULSUDYLVHMLKODKNRV)LVFKHUMHYRHVWHULILNDFLMRVROLPDORQVNHNLVOLQH 6OHGQMRODKNRSULSUDYLPR]UHDNFLMRQDWULMHYHVROLNORURRFHWQHNLVOLQHLQ1D&1WHPXSD VOHGLED]LþQDKLGUROL]D>@0DORQDWQLHVWULQSUGLHWLOPDORQDWVHXSRUDEOMDMR]DVLQWH]R UD]OLþQLKSRPHPEQLKRUJDQVNLKVSRMLQYNOMXþQR]EDUELWXUDWLLQXPHWQLPLDURPDPL

$ONLOFLDQRDFHWDWL

$ONLOFLDQRDFHWDWLVRHVWULFLDQRRFHWQHNLVOLQH>@9LQGXVWULMLVHMLKODKNRSULSUDYLSUHNR )LVFKHUMHYH HVWHULILNDFLMH FLDQRRFHWQH NLVOLQH ] L]EUDQLP DONRKRORP Y SULVRWQRVWL NRQFHQWULUDQH åYHSORYH NLVOLQH 'RGDWQD PRåQRVW SULSUDYH MH UHDNFLMD L]EUDQHJD DONLO NORURDFHWDWD ] 1D&1 >@ =DUDGL UD]OLþQLK IXQNFLRQDOQLK VNXSLQ QLWULOQD LQ HVWUVND LPDMRDONLOFLDQRDFHWDWLSUHFHMãHQLQGXVWULMVNLSRWHQFLDOQSUYSURL]YRGQMLFLDQRDNULODWRY YDYWRPRELOVNLLQGXVWULML>@LQ]DXYDMDQMHQLWULOQHVNXSLQHYDULOKDOLGH>@

(22)

)'åHURVNL 6HOHNWLYQH0LFKDHORYHDGLFLMHEUH]WRSLO

,]EUDQL0LFKDHORYLGRQRUML .DONRQL

.DONRQEHQ]DODFHWRIHQRQLQQMHJRYLGHULYDWLVRRUJDQVNHVSRMLQHNLVSDGDMRPHGĮȕ QHQDVLþHQH NHWRQH R] HQRQH 7DNãQH VSRMLQH LPDMR GYRMQR YH] &±2 NRQMXJDWLYQR ] GYRMQR YH]MR &±& NDU SRPHQL GD MX ORþXMH HQD VDPD HQRMQD YH] &±& 7R RPRJRþD L]UDåDQMH ODVWQRVWL YVDNH RG QMLKRYLK SRVDPH]QLK IXQNFLRQDOQLK VNXSLQ 1HNDWHUL NDONRQRYLGHULYDWLLPDMRSUHFHMãHQIDUPDNRORãNLSRWHQFLDO]DUDGLQMLKRYHJDSURWLYQHWQHJD GHORYDQMD >@ VSHW GUXJL SD VH XSRUDEOMDMR Y LQGXVWULML NRW SUHKUDQVNL GRGDWNL QSU QHRKHVSHULGLQKLGURNDONRQ>@7LSLþQRODKNRNDONRQLQRVWDOHĮȕQHQDVLþHQHNHWRQH SULSUDYLPR ] DOGROQR NRQGHQ]DFLMR >@ .DONRQ ODKNR QSU VLQWHWL]LUDPR ] UHDNFLMR EHQ]DOGHKLGDLQDFHWRIHQRQDYED]LþQLKSRJRMLK>@

1LWURDONHQL

1LWURDONHQLVRRUJDQVNHVSRMLQHNLLPDMRQLWURVNXSLQRSRYH]DQR ]GYRMQRYH]MR&±&

JUH]DNRQMXJDWLYHQVLVWHP>@1LWURDONHQLVRSRPHPEQLUHDNWDQWLYRUJDQVNLNHPLML NHUMHQLWURVNXSLQD]HORPRþQDHOHNWURQSULYODþQDVNXSLQDLQVHMRODKNRSUHWYRULYGUXJH IXQNFLRQDOQHVNXSLQHNRWVRDPLQVNDKLGURNVLODPLQVNDD]RLQNDUERQLOQDVNXSLQD>@

1LWURDONHQL VR WXGL GREUR DNWLYLUDQL DONHQL NDU SRPHQL GD ODKNR VRGHOXMHMR Y 'LHOV±

$OGHUMHYLKUHDNFLMDKNRWGLHQRILOL>@SROHJWHJDSDVRSRPHPEQLWXGLYIDUPDFHYWVNLLQ DJURNHPLþQLLQGXVWULML>@1LWURDONHQHODKNRSULSUDYLPRV+HQU\MHYRUHDNFLMR>@±JUH ]D UHDNFLMR PHG QLWURDONDQL LQ DOGHKLGL DOL NHWRQL SRG ED]LþQLPL SRJRML >@ ± DOL ] GLUHNWQLPQLWULUDQMHPDONHQD]12LQ$O2SRGNLVOLPLSRJRML>F@

0HGNRQMXJDWLYQHQLWURDONHQHXYUãþDPRWXGLȕQLWURVWLUHQ1MHJRYLGHULYDWLLPDMRYHOLN SRWHQFLDOYELRORãNLLQIDUPDFHYWVNLLQGXVWULML]DUDGLQMLKRYHSURWLEDNWHULMVNHLQSURWL UDNRWYRUQHDNWLYQRVWL>@'HULYDWLȕQLWURVWLUHQDVHXSRUDEOMDMRãH]DSURL]YRGQMR SLUROQLK GHULYDWRY >@ ȕQLWURVWLUHQ ODKNR VLQWHWL]LUDPR ] UHDNFLMR EHQ]DOGHKLGD LQ QLWURPHWDQDSRGED]LþQLPLSRJRMLLQQDGDOMQMLPNLVOLQVNLPGHKLGURJHQLUDQMHP>@

(23)

7

1.2 Reakcije brez topil

1.2.1 Problematika topil

Pri kemijskih reakcijah se pogosto uporabljajo topila. Ta namreč vplivajo na reaktivnost in s tem na hitrost in rezultat reakcije. Štiri glavne funkcije topil so [39]:

 omogočiti difuzijo reaktantov in katalizatorjev,

 sprejemanje in prenos toplote, potrebne za kemijsko pretvorbo,

 stabilizacija prehodnih stanj in

 preprečiti neželene stranske reakcije z redčenjem.

Po drugi strani so topila velik izziv za zeleno kemijo, ker pogosto predstavljajo večino masnih izgub sinteznih procesov in s tem večino industrijskih odpadkov. Poleg tega so običajna topila (npr. toluen) pogosto strupena, vnetljiva in/ali jedka. Njihova hlapnost in topnost prispevata k onesnaževanju zraka, vode in tal, hkrati pa povečujeta stopnjo tveganja in možnost nesreč na delovnem mestu [40]. Celó recikliranje topil je dostikrat nepopolno [41]. Zaradi vseh teh pomanjkljivosti topil se vedno več pozornosti namenja reakcijam brez topil. Glavna ideja je, da bi se v celoti izognili uporabi topila, za doseg tega cilja pa potrebujemo nove pristope (glede na fizikalne lastnosti uporabljenih reagentov oz. želeno pretvorbo), ki bodo omogočili potek takšnih reakcij [40].

1.2.2 Opredelitev reakcij brez topil

Natančna opredelitev reakcij "brez topil" ni trivialna. Mehanokemične reakcije – to so reakcije, ki jih povzroča mehanska energija – med reaktanti v trdnem stanju so splošno sprejete kot reakcije brez topil. To pa ne velja za reakcije, ki vsebujejo tekoče reaktante, saj lahko slednji delujejo tudi kot topila, zlasti kadar so prisotni v velikem presežku glede na druge (trdne) komponente. V praksi privzamemo, da so reakcije brez topil tiste, kjer so v reakcijski zmesi prisotni le reaktanti in katalizatorji [39].

Reakcije brez topil imajo več prednosti: lahko zmanjšajo volumen reakcijskega sistema, povečajo učinkovitost reakcij in zmanjšajo možnosti nastanka odpadkov [42]. Prav zato je eno ključnih področij zelene kemije odstranjevanje topil v kemijski procesih. Najboljša rešitev je razvoj alternativnih procesov brez topil, vendar je včasih topilo ključnega pomena za proces (npr. za učinkovitost katalizatorja [41]). V tem primeru bi morali nevarna topila zamenjati z okolju in zdravju prijaznimi alternativnimi topili [43].

(24)

F. Džeroski Selektivne Michaelove adicije brez topil

8

1.2.3 Alternativna topila

V zadnjem času je uporaba alternativnih topil, predvsem vode, superkritičnih tekočin in ionskih tekočin, vse večja [43]. Superkritične tekočine so snovi, katerih stanje je nad kritično točko. Med njimi je superkritični ogljikov dioksid še posebej priročen. Nad kritično točko je CO2 tekoč in deluje kot topilo, ki omogoča potek reakcij. Z znižanjem tlaka in temperature pod kritično točko pa se CO2 pretvori v plin. Na ta način lahko popolnoma odstranimo topilo iz reakcijske zmesi, zato so superkritične tekočine dragocena alternativa. Ionske tekočine, tj. soli, ki so pri temperaturi pod 100 °C v tekočem stanju [39], so prav tako pomembna alternativa, saj imajo ugodne fizikalne lastnosti, predvsem zelo nizko vnetljivost in parni tlak [40]. Po drugi strani pa je voda premalo izkoriščeno topilo za organske reakcije [44].

1.2.4 Voda kot zeleno topilo

Voda je najpogostejša molekula na našem planetu [40] in ima kot taka številne prednosti:

je nestrupena, nevnetljiva, na voljo jo je v izobilju in poceni je [45]. Uporaba vode omogoča tudi lažjo separacijo, saj se mnoge organske spojine ne topijo v vodi in lahko izkoristimo hidrofobni efekt [40]. Če imamo npr. dvofazni sistem, v katerem je katalizator v vodni fazi in produkt v organski fazi, lahko z ločevanjem faz recikliramo katalizator [45]. Vseeno pa voda ni brez pomanjkljivosti: mnogi reagenti niso kompatibilni z vodo, kar otežuje potek reakcij v vodni fazi, kjer je nujna vsaj zmerna topnost [44]. Poleg tega je čiščenje onesnažene vode energetsko potraten proces [40].

1.3 Zelena kemija

1.3.1 Osnove zelene kemije

Zelena kemija je uporaba niza načel, ki zmanjšujejo ali odpravljajo uporabo ali nastajanje nevarnih snovi pri načrtovanju, proizvodnji in uporabi kemičnih izdelkov [43]. Pojem zelene kemije se je prvič pojavil v devetdesetih letih prejšnjega stoletja. To področje se ukvarja z dosegom trajnosti na molekularnem nivoju, zato je zanimanje za to področje vse večje, tako z okoljskega kot z ekonomskega vidika. Vodilno načelo zelene kemije je načrtovanje okolju prijaznih proizvodov in procesov, uteleša pa ga dvanajst principov, ki sta jih predlagala Anastas in Warner leta 1998 [40].

(25)

9

1.3.2 Dvanajst principov zelene kemije

Dvanajst temeljnih principov zelene kemije lahko povzamemo takole [46, 47]:

1. Preprečiti nastanek odpadkov. Bolje je preprečiti nastajanje odpadkov kot odpadke obdelovati ali odstranjevati, potem ko so nastali.

2. Atomska ekonomičnost. Sintezne poti morajo biti zasnovane tako, da maksimizirajo vključitev vseh uporabljenih reaktantov v reakciji v končni produkt.

3. Varnejša sinteza. Sintezne poti morajo biti načrtovane tako, da se izognemo uporabi in nastanku snovi, ki so strupene za okolje in ljudi, če je to le možno.

4. Varnejše kemikalije in produkti. Produkti kemijskih reakcij morajo biti čim bolj učinkoviti, obenem pa ne smejo biti nevarni.

5. Varne pomožne snovi. Uporabi pomožnih snovi (topil, sredstev za ločevanje itd.) se izognemo, kadar je to mogoče, sicer pa uporabimo kar se da neškodljive pomožne snovi.

6. Večja energetska učinkovitost. Upoštevamo energetske potrebe procesov in njihov vpliv na okolje in gospodarstvo ter jih čim bolj zmanjšamo. Sintezne reakcije je treba izvajati pri sobni temperaturi in tlaku.

7. Uporaba obnovljivih virov. Uporabljajmo obnovljive surovine in materiale, kadarkoli je to tehnično in ekonomsko izvedljivo.

8. Izogibanje dodatnim pretvorbam. Izogibajmo se nepotrebni derivatizaciji (npr.

zaščiti in odstranitvi funkcionalnih skupin), saj to povzroča le dodatne stroške in daljši čas izvajanja reakcij.

9. Prednost katalitskih reakcij pred stehiometrijskimi. Bolje je uporabiti selektiven katalizator kot pa stehiometrično količino reagenta, sploh če katalizator lahko uporabimo večkrat.

10. Razgradljive kemikalije in produkti. Kemijski produkti morajo biti zasnovani tako, da se po koncu uporabe ne akumulirajo v okolju, temveč se razgradijo v neškodljive snovi.

11. Zmanjšanje onesnaženja z analizo v realnem času. Analitične metode je treba razvijati tako, da se omogoči spremljanje in nadzor postopkov v realnem času, hkrati pa se je treba izogniti nastanku nevarnih snovi.

12. Zmanjšanje možnosti nesreč. Snovi, ki se uporabljajo v kemijskem procesu, in njihovo obliko je treba izbrati tako, da se zmanjša možnost nesreč, vključno z izpusti, eksplozijami in požari.

(26)

F. Džeroski Selektivne Michaelove adicije brez topil

10

1.3.3 Atomska ekonomija in E-faktor

Med odpadke štejemo snovi brez željene vrednosti. Odpadki so lahko različnih oblik in lahko različno vplivajo na okolje (odvisno od njihove narave, strupenosti, količine, načina sproščanja), zato pri načrtovanju procesa želimo njihovo količino minimizirati.

Prav tako želimo minimizirati neizkoriščeno energijo. Tu se lahko poslužimo koncepta atomske ekonomije oz. atomske učinkovitosti, ki ga je prvi predstavil Barry Trost leta 1990. Ideja atomske ekonomije je maksimizirati uporabo surovin tako, da produkt vsebuje čim večje število atomov reaktantov [40] (največji delež reaktantov se pretvori v željen produkt [44]). Atomska ekonomija je torej razmerje med maso želenega produkta in vsoto mase reaktantov. Idealna reakcija bi v produkte vključila vse atome reaktantov [40].

V podobne namene je leta 1992 Sheldon uvedel koncept E-faktorja [40]. E-faktor je razmerje med maso odpadkov in maso želenega produkta, kjer se kot odpadek obravnava vse, kar ni željen produkt (topila, preostali reagenti, katalizatorji itn.). Idealen E-faktor bi bil seveda nič.

Večji kot je faktor, več odpadkov nastane, s tem pa se poveča negativen vpliv na okolje.

Običajno se pri izračunu E-faktorja ne upošteva vode [45]. Atomska ekonomija in E- faktor nista edina parametra, ki ju je treba upoštevati pri načrtovanju sinteze (upoštevati je treba tudi npr. izkoristek reakcije, stroške surovin, zahteve topil, energije), sta pa dovolj pomembna v današnji industriji, kjer odpadki predstavljajo pomemben del stroškov proizvodnje [44].

(27)

11

2 Namen dela

Namen moje diplomske naloge je podrobno spoznati reakcije Michaelovih adicij in testirati nekatere izmed značilnih pretvorb. Reakcije želim izvesti brez prisotnosti topil (ali pa z uporabo zelenih topil, kot je npr. voda) ali dodatnega segrevanja. Prav tako je cilj dela držati se principov zelene kemije in pripraviti produkte s čim večjim izkoristkom.

V tem kontekstu nameravam najprej izvesti Michaelovo adicijo v zelenem topilu brez prisotnosti katalizatorja. V ta namen bom sintetiziral derivat rodanina preko multikomponentne reakcije v prisotnosti vode. Nato nameravam preizkusiti Michaelove adicije v prisotnosti katalizatorja brez uporabe topil, in sicer s kombinacijo štirih različnih donorjev oz. aktivnih metilenskih skupin in dveh različnih akceptorjev (α,β-nenasičen keton in nitroalken). Za katalizo bom izbral LiClO4 (Lewisova kislina) in Et3N (šibka baza). Vse navedene reakcije bom izvajal pri sobni temperaturi. Vse adicije nameravam najprej izvesti v manjšem merilu, da preverim, ali takšne adicije sploh potečejo. Nato pa bom vse uspešno potekle sinteze ponovil še v večjem merilu.

(28)

F. Džeroski Selektivne Michaelove adicije brez topil

12

(29)

13

3 Eksperimentalni del 3.1 Uporabljene kemikalije

Pri diplomskem delu sem uporabil sledeče kemikalije: benzil amin, CS2, malein anhidrid, destilirana H2O, etil acetat, CH2Cl2, Na2SO4, benzalacetofenon, trans-β-nitrostiren, etil acetoacetat, dimetil malonat, metil cianoacetat, metil acetoacetat, LiClO4, Et3N, aceton, petrol eter, metanol, TMS, CDCl3.

3.2 Uporabljene aparature

Pri eksperimentalnem delu sem uporabil sledeče aparature:

 Rotacijski uparjalnik Büchi Rotavapor R-114,

 Rotacijski uparjalnik Heidolph Hei-VAP Advantage,

 UV svetilki valovnih dolžin 254 in 366 nm,

 Ultrazvočni homogenizer,

 OptiMelt MPA100,

 Bruker FTIR Alpha Platinum ATR IR spektrometer,

 Bruker DPX 300 MHz NMR spektrometer

 Bruker Avance III 500 MHz NMR spektrometer.

3.3 Sintezni postopki za izvedene reakcije

3.3.1 Sinteza (3-benzil-4-okso-2-tioksotiazolidin-5-il)ocetne kisline

V bučko sem natehtal 3 mmol (0,321 g) benzil amina, dodal 10 mL vode in 5 mmol (0,380 g) CS2. Nato sem v bučko dodal magnetno mešalo in zmes mešal 20 minut. Zatem sem v bučko dodal 3 mmol (0,2952 g) malein anhidrida in reakcijo pustil čez noč na sobni temperaturi ob kontinuirnem mešanju. Po koncu reakcije sem izvedel ekstrakcijo z dvakrat po 20 mL etil acetata in presežkom diklorometana (vodno fazo sem še enkrat spral z diklorometanom). Obe organski fazi sem kasneje združil v eno erlenmajerico, dodal brezvodni Na2SO4 in pustil, da se raztopina posuši. Topilo sem odstranil z uporabo rotacijskega uparjalnika in tako izoliral produkt (brez dodatnega čiščenja). Produkt sem analiziral z 1H NMR spektroskopijo (CDCl3, interni standard TMS, 300 MHz).

(30)

F. Džeroski Selektivne Michaelove adicije brez topil

14

3.3.2 Splošni postopek za Michaelove adicije v manjšem merilu

V bučko sem natehtal 1 mmol Michaelovega akceptorja in 1,2 mmol Michaelovega donorja (razmerje dejanske množine je sicer 1 : 1,2, a reakcija poteče v razmerju 1 : 1).

Nato sem v bučko dodal še vsaj 0,05 mol% LiClO4 in 1 mol% Et3N. Reakcijsko zmes sem mešal na sobni temperaturi čez noč na magnetnem mešalniku. Produkt reakcije sem ekstrahiral s 15 mL diklorometana in 5 mL vode (z navedeno količino sem predhodno spral bučko). Potrebno je bilo samo enkratno spiranje z vodo. Ekstrakt sem prenesel v erlenmajerico in ga posušil z brezvodnim Na2SO4. Preostalo topilo sem uparil z uporabo rotacijskega uparjalnika in s tem izoliral produkt (brez dodatnega čiščenja). Posušene produkte sem analiziral z 1H NMR spektroskopijo (CDCl3, TMS, 300 MHz).

Spektroskopska analiza je podana le pri reakcijah v manjšem merilu, čeprav je bila izvedena tako za reakcije v manjšem kot za reakcije v večjem merilu. Za reakcije, ki so bile izvedene tako v manjšem kot v večjem merilu, sem za analizo izbral spekter, ki je bil boljše ločljivosti oz. je ustrezal čistejšemu produktu. Praviloma je to bil spekter produkta pri reakciji v večjem merilu, razen za spojino 20. Za nekatere reakcije sem namesto 1 in 1,2 mmol natehtal 0,5 in 0,6 mmol, potrebna količina katalizatorjev pa je ostala ista.

3.3.3 Splošni postopek za Michaelove adicije v večjem merilu

V bučko sem natehtal 5 mmol Michaelovega akceptorja in 6 mmol Michaelovega donorja, nato pa dodal še vsaj 0,25 mmol LiClO4 in 0,05 mmol Et3N. Reakcijsko zmes sem mešal na sobni temperaturi čez noč na magnetnem mešalniku. Naslednji dan sem s TLC preveril, ali je reakcija končana (glej Sliko 1). Vse reakcije so potekle do konca, zato sem nadaljeval z izolacijo. Produkt reakcije sem očistil s prekristalizacijo, sledilo je nučiranje.

Posušenemu produktu sem izmeril tališče, posnel IR spekter (glej priloge 7.1 do 7.5) in ga analiziral z 1H NMR spektroskopijo na enak način kot pri reakcijah v manjšem merilu.

Slika 1: Izvedba TLC za reakcije v večjem merilu.

(31)

15

Po koncu reakcije sem na priporočilo profesorja združil produkte reakcij v manjšem in v večjem merilu. Končne produkte sem tehtal šele po IR analizi, 1H NMR spektroskopiji in določitvi tališča, zato so mase nekoliko nižje.

3.4 Reakcije v manjšem merilu

3.4.1 Sinteza (3-benzil-4-okso-2-tioksotiazolidin-5-il)ocetne kisline (spojina 5)

1 2 3 4 5

Shema 1: Sinteza (3-benzil-4-okso-2-tioksotiazolidin-5-il)ocetne kisline.

Sintezni podatki:

- 1: n = 3 mmol; M = 107,15 g/mol; m = 321 mg - 2: n = 5 mmol; M = 76,14 g/mol; m = 380 mg - 3: n = 3 mmol; M = 98,06 g/mol; m = 295 mg - 4: n = 10 mmol; M = 18,02 g/mol; V = 10,0 ml - 5: m = 308 mg; M = 281,35 g/mol

- Izkoristek: 37 %

Opombe: Sinteza je potekala pod pogoji, ki so opisani v splošnem postopku. Med ekstrakcijo je prišlo do velikih izgub, ker je produkt dokaj polaren in slabše topen v uporabljenih topilih.

Spektroskopska analiza:

- 1H NMR: (300 MHz, CDCl3) δ 8,90 (šs, 1H), 7,18 – 7,45 (m, 5H), 5,18 (ABkvartet, J = 14,2 Hz, 2H), 4,43 (d, J = 8,2 Hz, 1H), 3,28 (d, J = 18,0 Hz, 1H), 3,02 (dd, J = 18,0, 8,9 Hz, 1H).

Izgled: Rumena trdna snov.

(32)

)'åHURVNL 6HOHNWLYQH0LFKDHORYHDGLFLMHEUH]WRSLO

6LQWH]DHWLODFHWLORNVRGLIHQLOSHQWDQRDWDVSRMLQD

6KHPD6LQWH]DHWLODFHWLORNVRGLIHQLOSHQWDQRDWD 6LQWH]QLSRGDWNL

Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ

P PJ0 JPRO

,]NRULVWHN

2SRPEH6LQWH]DMHSRWHNDODSRSRJRMLKRSLVDQLKYVSORãQHPSRVWRSNX

6SHNWURVNRSVNDDQDOL]D

+1050+]&'&Oį±P+±P+±

P+±P+±P+G- +]+

T- +]+±P+V+W- +]+

,]JOHG%HODWUGQDVQRY

(33)

6LQWH]DHWLODFHWLOQLWURIHQLOEXWDQRDWDVSRMLQD

6KHPD6LQWH]DHWLODFHWLOQLWURIHQLOEXWDQRDWD

6LQWH]QLSRGDWNL

Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ

P PJ0 JPRO

,]NRULVWHN

2SRPEH6LQWH]DMHSRWHNDODSRSRJRMLKRSLVDQLKYVSORãQHPSRVWRSNX

6SHNWURVNRSVNDDQDOL]D

+1050+]&'&Oį±P+±P+

±P+V+V+W- +]+W-

+]+

,]JOHG%HORRUDQåQLNULVWDOL

(34)

)'åHURVNL 6HOHNWLYQH0LFKDHORYHDGLFLMHEUH]WRSLO

6LQWH]DGLPHWLOQLWURIHQLOHWLOPDORQDWDVSRMLQD

6KHPD6LQWH]DGLPHWLOQLWURIHQLOHWLOPDORQDWD

6LQWH]QLSRGDWNL

Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ

P PJ0 JPRO

,]NRULVWHN

2SRPEH6LQWH]DMHSRWHNDODSRSRJRMLKRSLVDQLKYVSORãQHPSRVWRSNX

6SHNWURVNRSVNDDQDOL]D

+1050+]&'&Oį±P+±P+

±P+G- +]+V+V+

,]JOHG2OMQDWDWHPQRUXPHQDWHNRþLQD

(35)

6LQWH]DGLPHWLORNVRGLIHQLOSURSLOPDORQDWDVSRMLQD

6KHPD6LQWH]DGLPHWLORNVRGLIHQLOSURSLOPDORQDWD

6LQWH]QLSRGDWNL

Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ

P PJ0 JPRO

,]NRULVWHN

2SRPEH = L]YHGER 7/& VHP XJRWRYLO GD MH UHDNFLMD SRWHNOD åH SR PLQXWDK 1DGDOMQMDL]RODFLMDSURGXNWDMHSRWHNDODSRVSORãQHPSRVWRSNX

6SHNWURVNRSVNDDQDOL]D

+1050+]&'&Oį±P+±P+

±P+±P+±P+G- +]

+V+±P+

,]JOHG%HODWUGQDVQRY

(36)

)'åHURVNL 6HOHNWLYQH0LFKDHORYHDGLFLMHEUH]WRSLO

6LQWH]DPHWLOFLDQRQLWURIHQLOEXWDQRDWDVSRMLQD

6KHPD6LQWH]DPHWLOFLDQRQLWURIHQLOEXWDQRDWD

6LQWH]QLSRGDWNL

Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ

P PJ0 JPRO

,]NRULVWHN

2SRPEH3UHWYRUEDMHSRWHNODSRSRJRMLKRSLVDQLKYVSORãQHPSRVWRSNX

6SHNWURVNRSVNDDQDOL]D

+1050+]&'&Oį±P+±P+

±P+±P+±P+V+V+

,]JOHG7HPQRRUDQåQDROMQDWDWHNRþLQD

(37)

6LQWH]DPHWLOFLDQRRNVRGLIHQLOSHQWDQRDWDVSRMLQD

6KHPD6LQWH]DPHWLOFLDQRRNVRGLIHQLOSHQWDQRDWD

6LQWH]QLSRGDWNL

Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ

P PJ0 JPRO

,]NRULVWHN

2SRPEH3UHWYRUEDMHSRWHNDODSRSRJRMLKQDYHGHQLKYVSORãQHPSRVWRSNX

6SHNWURVNRSVNDDQDOL]D

+1050+]&'&Oį±P+±P+

±P+±P+±P+±P+

V+±P+V+±P+±P+

,]JOHG6PROQDWDUXPHQNDVWDWHNRþLQD

(38)

)'åHURVNL 6HOHNWLYQH0LFKDHORYHDGLFLMHEUH]WRSLO

6LQWH]DPHWLODFHWLOQLWURIHQLOEXWDQRDWDVSRMLQD

6KHPD6LQWH]DPHWLODFHWLOQLWURIHQLOEXWDQRDWD

6LQWH]QLSRGDWNL

Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ

P PJ0 JPRO

,]NRULVWHN

2SRPEH5HDNFLMRVHPXVWDYLOSRPLQXWDKþHSUDYQLVHPRYUHGQRWLONRQFDUHDNFLMH V7/&6LQWH]DMHSRWHNDODSRSRJRMLKRSLVDQLKYVSORãQHPSRVWRSNXLQEUH]GRGDWQHJD þLãþHQMDSURGXNWD

6SHNWURVNRSVNDDQDOL]D

+1050+]&'&Oį±P+±P+

±P+G- +]+V+V+

,]JOHG7HPQRUXPHQLNULVWDOL

(39)

6LQWH]DPHWLODFHWLORNVRGLIHQLOSHQWDQRDWDVSRMLQD

6KHPD6LQWH]DPHWLODFHWLORNVRGLIHQLOSHQWDQRDWD

6LQWH]QLSRGDWNL

Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ

P PJ0 JPRO

,]NRULVWHN

2SRPEH6LQWH]DMHSRWHNDODSRSRJRMLKRSLVDQLKYVSORãQHPSRVWRSNX

6SHNWURVNRSVNDDQDOL]D

+1050+]&'&Oį±P+±P+

±P+±P+±P+G- +]+

V+±P+V+

,]JOHG%HODWUGQDVQRY

(40)

)'åHURVNL 6HOHNWLYQH0LFKDHORYHDGLFLMHEUH]WRSLO

5HDNFLMHYYHþMHPPHULOX

6LQWH]DHWLODFHWLORNVRGLIHQLOSHQWDQRDWDVSRMLQD

6KHPD6LQWH]DHWLODFHWLORNVRGLIHQLOSHQWDQRDWDSRQRYOMHQD6KHPD

6LQWH]QLSRGDWNL

Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ P PJ0 JPRO

,]NRULVWHN

7DOLãþH±ƒ&

2SRPEH 6LQWH]D MH SRWHNDOD SR SRJRMLK RSLVDQLK Y VSORãQHP SRVWRSNX 3UL SUHNULVWDOL]DFLMLVHPNRWWRSLODXSRUDELODFHWRQGLNORURPHWDQLQSHWUROHWHU

6SHNWURVNRSVNDDQDOL]D *OHMVWUDQ

,]JOHG%HODWUGQDVQRY

(41)

6LQWH]DGLPHWLOQLWURIHQLOHWLOPDORQDWDVSRMLQD

6KHPD6LQWH]DGLPHWLOQLWURIHQLOHWLOPDORQDWDSRQRYOMHQD6KHPD

6LQWH]QLSRGDWNL

Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ

P PJ0 JPRO

,]NRULVWHN

7DOLãþH±ƒ&

2SRPEH3RL]YHGEL7/&VHPSURGXNWUHDNFLMHL]ROLUDO]HNVWUDNFLMRYLVWHPUD]PHUMX YROXPQRYGLNORURPHWDQDLQYRGHNRWYUHDNFLMDKYPDQMãHPPHULOXP/P/=D HNVWUDNFLMR VHP SRUDELO P/ GLNORURPHWDQD LQ P/ YRGH 1DGDOMQMD L]RODFLMD MH SRWHNDODSRVSORãQHPSRVWRSNX3ULSUHNULVWDOL]DFLMLVWD VHGLNORURPHWDQLQSHWUROHWHU L]ND]DOD]DQHXVWUH]QLWRSLOL]DWRVHPXSRUDELOPHWDQRO

6SHNWURVNRSVNDDQDOL]D *OHMVWUDQ

,]JOHG5XPHQDWUGQDVQRY

(42)

)'åHURVNL 6HOHNWLYQH0LFKDHORYHDGLFLMHEUH]WRSLO

6LQWH]DGLPHWLORNVRGLIHQLOSURSLOPDORQDWDVSRMLQD

6KHPD6LQWH]DGLPHWLORNVRGLIHQLOSURSLOPDORQDWD6KHPDNUDMãLþDV

6LQWH]QLSRGDWNL

Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ

P PJ0 JPRO

,]NRULVWHN

7DOLãþH±ƒ&

2SRPEH 6LQWH]D MH SRWHNDOD SUL SRJRMLK RSLVDQLK Y VSORãQHP SRVWRSNX 3UL SUHNULVWDOL]DFLMLVHPNRWWRSLORXSRUDELODFHWRQ3URGXNWVHYQMHPQLUD]WDSOMDO]DWRVHP XSRUDELOXOWUD]YRþQRNRSHONLVHMHL]ND]DOD]DXþLQNRYLWR

6SHNWURVNRSVNDDQDOL]D *OHMVWUDQ

,]JOHG%HODWUGQDVQRY

(43)

6LQWH]DPHWLODFHWLOQLWURIHQLOEXWDQRDWDVSRMLQD

6KHPD6LQWH]DPHWLODFHWLOQLWURIHQLOEXWDQRDWD6KHPDGDOMãLþDV

6LQWH]QLSRGDWNL

Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ

P PJ0 JPRO

,]NRULVWHN

7DOLãþH±ƒ&

2SRPEH 6LQWH]D MH SRWHNDOD SR SRJRMLK RSLVDQLK Y VSORãQHP SRVWRSNX 3UL SUHNULVWDOL]DFLMLVHPNRWWRSLORXSRUDELOPHWDQRO3URGXNWVHYQMHPQLGREURUD]WDSOMDO ]DWRVHPXSRUDELOXOWUD]YRþQRNRSHONLVHMHL]ND]DOD]DXþLQNRYLWR

6SHNWURVNRSVNDDQDOL]D *OHMVWUDQ

,]JOHG%HåWUGQDVQRY

(44)

)'åHURVNL 6HOHNWLYQH0LFKDHORYHDGLFLMHEUH]WRSLO

6LQWH]DPHWLODFHWLORNVRGLIHQLOSHQWDQRDWDVSRMLQD

6KHPD6LQWH]DPHWLODFHWLORNVRGLIHQLOSHQWDQRDWDSRQRYOMHQD6KHPD

6LQWH]QLSRGDWNL

Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ Q PPRO0 JPROP PJ

P PJ0 JPRO

,]NRULVWHN

7DOLãþH±ƒ&

2SRPEH 6LQWH]D MH SRWHNDOD SR SRJRMLK RSLVDQLK Y VSORãQHP SRVWRSNX 3UL SUHNULVWDOL]DFLMLVHPNRWWRSLORXSRUDELODFHWRQ3URGXNWVHYQMHPQLUD]WDSOMDO]DWRVHP XSRUDELOXOWUD]YRþQRNRSHONLVHMHL]ND]DOD]DXþLQNRYLWR

6SHNWURVNRSVNDDQDOL]D *OHMVWUDQ

,]JOHG%HOLQEHåSUDK

(45)

29

4 Rezultati in razprava

Pri sintezi spojine št. 5 (stran 15, podpoglavje 3.4.1) sem se zgledoval po Halimehjani in Hosseinkhany [20], pri vseh ostalih reakcijah pa po Saidi in sodelavcih [5]. Reakcije v manjšem merilu so v veliki večini primerov dale dobre izkoristke (tipično 80–99 %). Z izjemo prve reakcije so pri vseh ostalih reakcijah izolacije potekale brez dodatnih težav.

Izolacija je pri vseh reakcijah v manjšem merilu vključevala le ekstrakcijo in vakuumsko odstranjevanje topila. Žal je 1H NMR spektroskopska analiza pokazala, da na takšen način dostikrat nisem uspel odstraniti presežnih reaktantov. Če je spektroskopska analiza pokazala uspešno konverzijo in dovolj dobro ujemanje z literaturo ter če je bil izkoristek zadovoljiv, sem reakcije izvedel še v večjem merilu.

Reakcije v večjem merilu so sicer vse potekle, a so v večini primerov potrebovale več časa. Izkoristki so bili različno dobri (39–94 %) in na splošno slabši kot na manjši skali.

V želji po optimizirani izvedbi reakcij in uspešni odstranitvi presežnih reaktantov, sem za izolacijo raje izbral prekristalizacijo in nučiranje. Zamenjava metode ni učinkovala v vseh primerih, je pa bila povečini uspešna (reakcije 2, 4, 5 in 9). Zaradi epidemije COVID-19 sem imel omejene možnosti za laboratorijsko delo in dostikrat nisem uspel bolje očistiti produktov.

Izbira topil za prekristalizacijo se je izkazala za najtežavnejši del izolacije, saj nisem poznal lastnosti produktov in presežnih reaktantov, kar je gotovo prispevalo k izgubi produkta. Med izolacijo sem združil produkte reakcij v manjšem in večjem merilu, končne produkte pa sem stehtal šele po opravljenih analizah, zato so vrednosti izkoristkov nekoliko nižje.

Pregled vseh različnih produktov reakcij je podan v Tabeli 1.

(46)

)'åHURVNL 6HOHNWLYQH0LFKDHORYHDGLFLMHEUH]WRSLO

7DEHOD3UHJOHGYVHKVLQWHWL]LUDQLKSURGXNWRY

6WUXNWXUDVSRMLQH ,PHVSRMLQH âWHYLONDVSRMLQH

EHQ]LORNVR WLRNVRWLD]ROLGLQ

LORFHWQDNLVOLQD

HWLODFHWLORNVR GLIHQLOSHQWDQRDW

HWLODFHWLOQLWUR IHQLOEXWDQRDW

GLPHWLOQLWUR IHQLOHWLOPDORQDW

GLPHWLORNVR GLIHQLOSURSLOPDORQDW

PHWLOFLDQRQLWUR IHQLOEXWDQRDW

PHWLOFLDQRRNVR GLIHQLOSHQWDQRDW

PHWLODFHWLOQLWUR IHQLOEXWDQRDW

PHWLODFHWLORNVR GLIHQLOSHQWDQRDW

(47)

31

4.1 Spojina 5: (3-benzil-4-okso-2-tioksotiazolidin-5-il)ocetna kislina

Izolacijo sem izvedel tako kot Halimehjani in Hosseinkhany [20], le da sem namesto ekstrakcije z dvakrat po 20 mL etil acetata uporabil še nekaj diklorometana (produkt je bil dokaj težko topen), da pospešim proces ekstrakcije. V praksi se namreč etil acetat rahlo meša z vodo, kar pomeni, da ločba komponent traja dlje. Posneti 1H NMR spekter se zelo dobro ujema z literaturo [20]. Produkt je torej zelo čist in ni videti nobenih ostankov reaktantov. Od ponovitve reakcije v večjem merilu me je odvrnil le relativno nizek izkoristek reakcije (37 %).

4.2 Spojina 10: etil 2-acetil-5-okso-3,5-difenilpentanoat

Pri tej reakciji sem uporabil 1 mmol benzalacetofenona in 1,2 mmol etil acetoacetata v skladu z delom Saidija in sodelavcev [5], pri sami izolaciji pa sem ubral drugačen pristop.

Namesto spiranja produktov z vodo sem izvedel ekstrakcijo s 15 mL diklorometana in 5 mL vode. Isti način izolacije sem uporabil pri vseh nadaljnjih reakcijah na mali skali. 1H NMR spekter produkta se dokaj dobro ujema z literaturo [48, 49]. V spektru sem ponekod opazil dvojno število protonov, ker je produkt zmes dveh diastereomerov. Produkt vsebuje še nekaj primesi, kar pomeni, da ni povsem čist in je dobljeni izkoristek v resnici le približek. Kljub temu sta me dobro ujemanje z literaturo in dober izkoristek prepričala, da reakcijo izvedem v večjem merilu.

Za isto reakcijo v večjem merilu sem pri prekristalizaciji kot topila uporabil aceton, diklorometan in petrol eter. Izmerjeno tališče 107,1 – 107,5 °C je podobno tališču, podanemu v literaturi (110 – 112 °C) [15]. 1H NMR spekter (opisan v podpoglavju 3.4.2) se dobro ujema z literaturo [48, 49]. V spektru tokrat ni opaziti dvojnega števila protonov, kar verjetno nakazuje na prevladovanje enega od diastereoizomerov. Sledovi manj zastopanega izomera so vidni pri δ = 2,00 (s) in pri 4,00 (d, J = 10,1 Hz). Razmerje integralov med večinskim in manjšinskim singletom pri 2,30 in 2,00 se ujema z razmerjem med večinskim in manjšinskim dubletom pri 4,02 in 4,00 (približno 5:1).

Dodaten signal pri δ = 1,25 (t, J = 7,1 Hz) pa kaže prisotnost sledi Et3N, ki tipično kaže triplet z enako sklopitvijo pri δ = 1,27 [50]. Tudi tokrat je bil izkoristek reakcije visok (94

%).

(48)

F. Džeroski Selektivne Michaelove adicije brez topil

32

4.3 Spojina 12: etil 2-acetil-4-nitro-3-fenilbutanoat

Žal je bil posneti 1H NMR spekter precej slabe ločljivosti, hkrati pa je pokazal odstopanje od literature [5, 34, 51]. Ponovno je prisotna neločljiva zmes dveh diastereomerov, s tem pa je vidno dvojno število protonov. V spektru sta prisotna tudi dodatna singleta pri δ = 3,44 in 2,27, ki bi lahko pripadala presežku etil acetoacetata [52], kar pomeni, da je tudi v tem primeru vrednost izkoristka le približna. Produkt je vseboval še sledove Et3N. Slaba čistost in neujemanje spektrov z literaturnimi sta me odvrnila od ponovitve reakcije v večjem merilu.

4.4 Spojina 14: dimetil 2-(2-nitro-1-feniletil)malonat

Surov produkt v manjšem merilu je vseboval še znaten presežek dimetil malonata. Kljub temu so se rezultati dobro ujemali z literaturo [5, 53], zato sem reakcijo izvedel še v večjem merilu. Za reakcijo v večjem merilu sem produkt reakcije izoliral z ekstrakcijo, in sicer s 65 mL diklorometana in 21 mL vode. Pri prekristalizaciji sta se diklorometan in petrol eter izkazala za neustrezni topili, zato sem kot topilo uporabil metanol. Uporaba različnih dodatnih topil je prispevala k slabšemu izkoristku reakcije (39 %). Izmerjeno tališče 60,6 – 61,0 °C ustreza podanemu tališču v literaturi (63 °C) [54]. Rezultati spektroskopske analize se dobro ujemajo z literaturo [5, 53]. Iz 1H NMR spektra (opisanga v podpoglavju 3.4.4) izhaja, da sem izoliral čist produkt.

4.5 Spojina 15: dimetil 2-(3-okso-1,3-difenilpropil)malonat

Reakcija v manjšem merilu je potekla zelo hitro in sem jo ustavil že po 30 minutah. 1H NMR spekter se je zelo dobro ujemal z literaturo [4, 32] z izjemo presežka dimetil malonata. Zaradi dobrega izkoristka (87 %) in odsotnosti nečistot sem reakcijo izvedel v večjem merilu. Za reakcijo v večjem merilu sem pri prekristalizaciji za topilo uporabil aceton, a se produkt v njem ni raztapljal, zato sem za učinkovito raztopitev uporabil ultrazvočno kopel. Izkoristek reakcije je sprejemljiv (56 %). Izmerjeno tališče 104,3 – 104,8 °C se ujema s tališčem, podanim v literaturi (104 – 106 °C) [55], spektroskopski rezultati prav tako [5, 53]. Tako kot pri prejšnji reakciji se je prekristalizacija izkazala za uspešno metodo čiščenja produkta.

(49)

33

4.6 Spojina 17: metil 2-ciano-4-nitro-3-fenilbutanoat

Pri reakciji sem za sintezo produkta uporabil β-nitrostiren in metil cianoacetat. 1H NMR spekter (opisan v podpoglavju 3.4.6) se je dobro ujemal z literaturnim [56]. Ponovno je prisotna zmes dveh diastereomerov, s tem pa je vidno dvojno število protonov. Prisotna sta tudi dodatna signala pri δ = 3,46 (s, 2H) in 3,83 (s, 3H), ki bi lahko pripadala presežku metil cianoacetata [57]. V primerjavi z ostalimi reakcijami v manjšem merilu je ta 1H NMR spekter pokazal večjo količino presežnega reaktanta, kar pomeni, da verjetno ni prišlo do popolne konverzije. Slabša konverzija v produkt in slaba čistost sta bila razlog, da reakcije nisem izvedel v večjem merilu.

4.7 Spojina 18: metil 2-ciano-5-okso-3,5-difenilpentanoat

Pri reakciji sem za sintezo produkta uporabil benzalacetofenon in metil cianoacetat. Za posneti 1H NMR spekter nisem našel primerjave v literaturi. 1H NMR spekter je ponovno pokazal prisotnost diastereomerov in dvojno število protonov. Signala pri δ = 3,46 (s, 2H) in 3,83 (s, 3H) bi lahko pripadala metil cianoacetatu [57]. Tako kot v prejšnji reakciji je

1H NMR spekter pokazal večji presežek reaktanta in nepopolno konverzijo. Ker reakcija ni dovolj dobro potekla, sem se odločil, da reakcije ne izvedem v večjem merilu.

4.8 Spojina 20: metil 2-acetil-4-nitro-3-fenilbutanoat

Reakcija v manjšem merilu je potekla že po 160 minutah. Tokrat je v 1H NMR spektru (opisanem v podpoglavju 3.4.8) opaziti presežek enega od diastereoizomerov. Manjšinski izomer ima vrhove pri δ = 2,05 (s, 1H), 3,77 (s, 1H), 4,05 (d, J = 9,7 Hz, 1H) in 4,81 – 4,86 (m, 1H). Razmerje integralov med večinskim in manjšinskim singletom pri 2,29 in 2,05 se ujema z razmerjem med večinskim in manjšinskim dubletom pri 4,13 in 4,05 (4:1). Pojavili so se še dodatni vrhovi pri δ = 2,27 (s, 1H), 3,46 (s, 1H) in 3,70 (s, 1H), ki kažejo na prisotnost metil acetoacetata [58]. Rezultati 1H NMR spektroskopske analize se relativno dobro ujemajo z literaturo [59] kljub nekaterim dodatnim vrhovom. Ker je bil tudi izkoristek dober (88 % je le približek), sem reakcijo izvedel še v večjem merilu.

Za reakcijo v večjem merilu sem pri prekristalizaciji za topilo uporabil metanol, ki se ni izkazal za učinkovitega, zato sem ponovno uporabil ultrazvočno kopel. Izkoristek reakcije je bil sprejemljiv (53 % je le približek). Izmerjeno tališče 70,6 – 70,9 °C odstopa od tališča, navedenega v literaturi (76 – 77 °C) [c59]. V 1H NMR spektru je opaziti presežek enega od izomerov. Manj zastopani izomer ima signale pri δ = 2,05 (s, 1H), 3,77 (s, 1H), 4,05 (d, J = 9,7 Hz, 1H) in 4,81 – 4,86 (m, 1H). Razmerje integralov je bilo videti

(50)

F. Džeroski Selektivne Michaelove adicije brez topil

34

podobno kot pri reakciji v manjšem merilu, a zaradi slabše ločljivosti vrhovi niso bili dovolj izraziti, da bi lahko podal natančno razmerje. Pojavili so se še zelo majhni vrhovi pri δ = 2,21 (s), 3,14 – 3,26 (m) in 3,69 (s), ki bi jih morda lahko pripisal presežku metil acetoacetata.

4.9 Spojina 21: metil 2-acetil-5-okso-3,5-difenilpentanoat

V 1H NMR spektru produkta reakcije v manjšem merilu ni bilo opaziti dvojnega števila protonov, hkrati ni bilo prisotnih nobenih očitnih signalov manjšinskega izomera. Možen vzrok bi lahko bil velik presežek enega izmed diastereomerov. Dodatni protoni pri δ = 2,28 (s, 3H) in 3,73 (s, 3H) bi lahko pripadali presežku acetoacetata, ki ima tipično signale v takšnem območju [58]. Visoka konverzija v produkt me je prepričala, da reakcijo izvedem še na večji skali.

Pri reakciji v večjem merilu sem za prekristalizacijo kot topilo uporabil aceton, a se v njem produkt ni raztapljal, zato sem si pomagal z uporabo ultrazvočne kopeli. Izkoristek reakcije je bil povprečen (43 %), za izmerjeno tališče 112,8 – 113,2 °C pa nisem našel primerjave v literaturi. V 1H NMR spektru (opisanem v podpoglavju 3.4.9) ponovno ni bilo opaziti dvojnega števila protonov. Z metodo prekristalizacije sem uspešno odstranil presežek metil acetoaceta, saj v spektru nisem opazil nobenih sledov reaktanta. V produktu še vedno prevladuje le en izomer, edina sled manj zastopanega izomera je vidna kot singlet pri δ = 3,61 ppm.

(51)

35

5 Zaključek

V svojem diplomskem delu sem se ukvarjal s selektivnimi Michaelovimi adicijami, in sicer brez uporabe topil – ali z uporabo zelenih topil – in brez dodatnega segrevanja ali ohlajanja. Pri eksperimentalnem delu sem izvedel tako Michaelove adicije v prisotnosti katalizatorjev LiClO4 in Et3N brez uporabe topil kot tudi Michaelovo adicijo v vodi brez prisotnosti katalizatorja. Večina reakcij je potekla po splošnem postopku in brez posebnosti. Celokupno sem pripravil 9 različnih produktov in potem izvedel 5 od devetih reakcij v večjem merilu. Produkte reakcij v manjšem merilu sem izoliral z ekstrakcijo in čistil z destilacijo, produkte reakcij v večjem merilu pa s prekristalizacijo.

Najbolj sem se osredotočil na adicijo aktiviranih metilenskih spojin (β-ketoester, malonat in alkil cianoacetat) na α,β-nenasičen keton (kalkon) in nitroalken (β-nitrostiren). Večina reakcij v manjšem merilu je potekla brez posebnosti in z visokimi izkoristki (≥ 80 %).

Ekstrakcija in destilacija običajno nista zadoščali za pripravo čistih produktov, zato sem za reakcije v večjem merilu izbral drugačen način čiščenja produktov, kar se je večkrat obrestovalo. Vse reakcije, ki sem jih izvedel še v večjem merilu, so uspešno potekle po 24 urah in dale zadovoljive izkoristke (39–94 %). Težave so se pojavile le pri izbiri topil za prekristalizacijo, kar je včasih prispevalo k slabšemu izkoristku reakcije. Poleg tipičnih Michaelovih adicij sem izvedel tudi sintezo derivata rodanina v prisotnosti vode, ki je dala sicer sprejemljiv, a nenavdušujoč izkoristek (37 %).

V celoti gledano so bila moja pričakovanja povečini izpolnjena. Glede na eksperimentalno delo so bile izvedene sinteze uspešne, moje delo pa je tudi pokazalo, da je v izolaciji produktov precej prostora za izboljšavo in bi bilo optimizacijo procesa vredno podrobneje raziskati.

(52)

F. Džeroski Selektivne Michaelove adicije brez topil

36

(53)

37

6 Literatura

[1] L. Da-Peng, X. Xin, D. Hai-feng, Y. Yan-zhen, G. Han, L. Ying-jie, X. Jia-ning:

Tetramethylguanidium lactate ionic liquid: catalyst-free medium for Michael addition reaction. Chem. Res. Chin. Univ. 2008, 24, 36–41.

[2] E. Reyes, U. Uria, J. L. Vicario, L. Carrillo: The catalytic, enantioselective Michael reaction. V: Organic reactions. Vol. 90, S. E. Denmark (ur.), Hoboken, NJ: Wiley 2016, str. 3–5.

[3] T. Tokoroyama: Discovery of the Michael reaction. Eur. J. Org. Chem. 2010, 2010, 2009–2016.

[4] C. Su, Y.-M. Xie, Q.-T. Zhang: Phase-transfer catalyzed Michael addition reaction using a new C2-symmetric quaternary ammonium salt derived from L-proline. Cat.

Lett. 2011, 141, 1004–1008.

[5] M. R. Saidi, N. Azizi, E. Akbari, F. Ebrahimi: LiCO4/Et3N: highly efficient and active catalyst for selective Michael addition of active methylene compounds under solvent- free condition. J. Mol. Catal. Chem. 2008, 292, 44–48.

[6] F. A. Carey, R. J. Sundberg: Advanced organic chemistry, 5th edition. Part B:

reactions and synthesis. Berlin: Springer 2007, str. 183–184.

[7] Y.-M. Ren, C. Cai: The Michael addition of active methylene compounds to chalcone derivatives using a catalytic amount of iodine and K2CO3 at room temperature. J.

Chem. Res. 2011, 35, 176–178.

[8] H. O. House, W. L. Roelofs, B. M. Trost: The Chemistry of Carbanions. XI. Michael Reactions with 2-Methylcyclopentanone and 2-Methylcyclohexanone. J. Org. Chem.

1966, 31, 646–655.

[9] E. M. Kaiser, C. L. Mao, C. F. Hauser, C. R. Hauser: Conjugate addition reactions of ethyl atropate with certain alkali nucleophiles. Alkylations. J. Org. Chem., 1970, 35, 410–414.

[10] E. C. Horning, A. F. Finelli: α-Phenyl-α-carbethoxyglutaronitrile. V: Organic Syntheses. Coll. Vol. 4, N. Rabjohn (ur.), Hoboken, NJ: Wiley 1963, str. 776.

[11] R. T. Morrison, R. N. Boyd: Organic chemistry, 6th Edition. New Delhi: Prentice- Hall of India 2002, str. 865–868.

(54)

F. Džeroski Selektivne Michaelove adicije brez topil

38

[12] K. P. C. Vollhardt, N. E. Schore: Organic chemistry: structure and function, 6th edition. New York, NY: W. H. Freeman & Co. 2011, str. 852, 1081, 1082.

[13] R. Navarro, C. Monterde, S. Molina, M. Perez-Perrino, F. Reviriego, A. del Prado, A. Gallardo, H. Reinecke: Understanding the regioselectivity of Michael addition reactions to asymmetric divinylic compounds. RSC Adv., 2017, 7, 56157–56165.

[14] S. Thiyagarajan V. Krishnakumar, C. Gunanathan: KOtBu-catalyzed Michael addition reactions under mild and solvent-free conditions. Chem. Asian J. 2020, 15, 518–523.

[15] S. Vijaikumar, K. Pitchumani: Efficient microwave activation of hydrotalcite clays in Michael addition under solvent-free conditions. Indian J. Chem. 2010, 49B, 469–

474.

[16] Z.-B. Xie, N. Wang, M.-Y. Wu, T. He, Z.-G. Le, X.-Q. Yu: Catalyst-free and solvent- free Michael addition of 1,3-dicarbonyl compounds to nitroalkenes by a grinding method. Beilstein J. Org. Chem. 2012, 8, 534–538.

[17] A. Loupy: Solvent-free reactions. V: Modern Solvents in Organic Synthesis. P.

Knochel (ur.), Berlin: Springer 1999, str. 182.

[18] W. Ye, J. Xu, C.-T. Tan, C.-H.. Tan: 1,5,7-Triazabicyclo[4.4.0]dec-5-ene (TBD) catalyzed Michael reactions. Tetrahedron Lett. 2005, 46, 6875–6878.

[19] T. Das, S. Mohapatra, N. P. Mishra, S. Nayak, B. P. Raiguru: Recent advances in organocatalytic asymmetric Michael addition reactions to α,β-unsaturated nitroolefins.

ChemistrySelect 2021, 6, 3745–3781.

[20] A. Ziyaei Halimehjani, S. Hosseinkhany: One-pot three-component route for the synthesis of rhodanine derivatives in water. Synthesis 2015, 47, 3147–3152.

[21] M. Nencki: Ueber die Einwirkung der Monochloressigsäure auf Sulfocyansäure und ihre Salze. J. Prakt. Chem. 1877, 16, 1–17.

[22] A. Alizadeh, N. Zohreh: A novel multicomponent method for the synthesis of 2- thioxo-1,3-thiazolidin-4-ones. Synlett 2009, 13, 2146–2148.

[23] J. Yang, C. Ji, Y. Zhao, Y. Li, S. Jiang, Z. Zhang, Y. Ji, W. Liu: BF3·OEt2: An efficient catalyst for transesterification of β-ketoesters. Synth. Commun. 2010, 40, 957–963.

[24] C. S. Palmer, P. W. McWherter: Ethyl bromomalonate. V: Organic Syntheses. Coll.

Vol. 1, A. H. Blatt (ur.), New York, NY: Wiley, 1943, str. 245.

(55)

39

[25] Alkyl cyanoacetate ester. ChEBI Ontology.

https://www.ebi.ac.uk/chebi/chebiOntology.do?treeView=true&chebiId=CHEBI:519 27 (pridobljeno 24. nov. 2021).

[26] J. K. H. Inglis: Ethyl acetoacetate. Org. Synth. 1928, 8, 74.

[27] L. V. B. Hoelz: Ethyl cyanoacetate (CAS No. 105-56-6). Rev. Virtual Quim. 2011, 3, 215–217.

[28] S. Zheng, C. Yu, Z. Shen: Ethyl Cyanoacetate: A new cyanating agent for the palladium-catalyzed cyanation of aryl halides. Org. Lett. 2012, 14, 3644–3647.

[29] D. K. Mahapatra, S. K. Bharti, V. Asati: Chalcone derivatives: anti-inflammatory potential and molecular targets perspectives. Curr. Top. Med. Chem. 2017, 17, 3146–

3169.

[30] F. A. Tomas-Barberan, M. N. Clifford: Flavanones, chalcones and dihydrochalcones – nature, occurrence and dietary burden. J. Sci. Food Agric. 2000, 80, 1073–1080.

[31] E. P. Kohler, H. M. Chadwell: Benzalacetophenone. Org. Synth. 1922, 2, 1.

[32] G. Rosini: The Henry (nitroaldol) reaction. V: Comprehensive organic syntheses.

vol. 2, B. M. Trost, I. Fleming (ur.), Oxford: Elsevier 1991, str. 322, 323, 324, 330.

[33] J. Ye, D. J. Dixon, P. S. Hynes: Enantioselective organocatalytic Michael addition of malonate esters to nitro olefins using bifunctional cinchonine derivatives. Chem.

Commun. 2005, 35, 4481–4483.

[34] G. Srihari, M. M. Murthy: Efficient method for the synthesis of Michael adducts using kaolin preloaded with KOH. Synth. Commun. 2009, 39, 896–906.

[35] T. Mukaiyama, E. Hata, T. Yamada: Convenient and simple preparation of nitroolefins nitration of olefins with nitric oxide. Chem. Lett. 1995, 24, 505–506.

[36] N. Milhazes, R. Calheiros, M. P. M. Marques, J. Garrido, M. N. D. S. Corderiro, C.

Rodrigues, S. Quinteira, C. Novais, L. Peixe, F. Borges: β-nitrostyrene derivatives as potential antibacterial agents: a structure–property–activity relationship study. Bioorg.

Med. Chem. 2006, 14, 4078–4088.

[37] H. Rostami, L. Shiri: Application of β-Nitrostyrene in Multicomponent Reactions for the Synthesis of Pyrrole Derivatives. ChemistrySelect 2020, 5, 11197–11220.

[38] B. S. Furniss, A. J. Hannaford, P. W. G. Smith, A. R. Tatchell: Vogel's textbook of practical organic chemistry, 5th Edition. London: Longman Scientific & Technical 1989, str. 1032, 1035.

Reference

POVEZANI DOKUMENTI

V letu 1985 sem na centru za'socialno delo Koper prevzel to področje dela in po intenzivnem usposabljanju v dveh terapevtskih skupinah in klubih terapevtske skupnosti Janeza

zumirali  produkte  kulturne  oziroma  medijske  industrije,  lahko

Complexes 1–2 were characterized by IR, ESI-MS, elemental analysis, 1 H NMR, UV-vis, FL spectra and cyclic voltammetry.. IR and

členjen po globokih prepadih. Njun planotast značaj sem mogel ugotoviti na licu mesta; ločena sta med seboj po manjšem sedlu. Vzhodni del planote vrh Srednje

ovrednotili z analizo skupnega organskega ogljika (TOC; ang. total organic carbon) v vzorcih, odvzetih pred in po koncu reakcije. Za določitev obsega adsorpcije bisfenolov

Nato napiši povedi, kjer boš uporabil-a čim več različnih predlogov.. Če bi bili v šoli, bi me najbrž vprašal-a: »Učitelj,

Med vidnim in nevidnim Zdravo, sem Klemen Skočir - študent zaključnega letnika na Akademiji za likovno umetnost in oblikovanje v Ljubljani in pripravljam diplomsko delo z naslovom

Sem Alenka Cimerman, študentka predšolske vzgoje na Pedagoški fakulteti Univerze v Ljubljani in pripravljam diplomsko delo z naslovom Bralna pismenost študentov

Za boljše razumevanje hrvaškega učnega načrta in zato, da sem izvedela več o pouku družboslovja na Hrvaškem, sem po opravljeni analizi in študiji dokumentov naredila intervju z

Za diplomsko delo z naslovom VLOGA STARŠEV V PROCESU RAZVIJANJA OTROKOVE PISMENOSTI V PREDŠOLSKEM OBDOBJU sem se odločila, ker sem hotela raziskati, kako pogosto

Diplomsko delo ima teoretični in empirični del. V teoretičnem delu sem najprej predstavila povezavo med otroki in tehniko, nadaljevala z razvojnimi značilnostmi otrok v starosti

Vrednotenje je bilo nekoliko drugačno, kot sem ga pričakovala glede na moje priporočilo učiteljici. Ni bilo skupinsko po vsakem končanem govornem nastopu, kjer bi

Sem absolventka razrednega pouka na Pedagoški fakulteti v Ljubljani. Pod mentorstvom izrednega profesorja dr. Igorja Sakside pišem diplomsko nalogo z naslovom

Sem študentka predšolske vzgoje na Pedagoški fakulteti v Ljubljani. Pri predmetu Metodika jezikovne vzgoje trenutno pišem diplomsko delo z naslovom Znanje slovenskega

HRANJENJE IN RAZVOJ PASJIH MLADIČEV V PRVIH OSMIH TEDNIH PO ROJSTVU.. DIPLOMSKO DELO

Sadje uporabljajo za svežo uporabo in predelavo v različne produkte (kis, sok, žganje in kot sušeno sadje). Da bi se sadjarstvo na Cerkljanskem razvijalo, bi bilo

Program je namenjen tistim, ki imajo teţave zaradi zasvojenosti z dro- gami, kakor tudi njihovim svojcem ter vsem tistim, ki se srečujejo s prepovedano drogo in iščejo

Vendar je prav ta odlo č itev že za č etek iskanja rešitve in reševanja problemov.. Vztrajanje v takšni razpetosti lahko dolgoro č no

To diplomsko delo obravnava uvajanje nove storitve, in sicer fotografiranje in snemanje z mini radijsko vodenim helikopterjem v manjšem podjetju v času gospodarske krize..

Tako pri analizi konkurence, kjer sem se osredotočila na proizvajalce vžignih sistemov za motocikle, kot tudi pri analizi kupcev, kjer sem proučevala proizvajalce motociklov, sem

Zaščito oziroma varstvo manjšin so v okviru OZN obravnavali skoraj izključno kot sestavni del sklopa, ki ga predstavljata pojma človekovih pravic in njihove zaščite. Medtem ko

Tako je na primer zadnji statistični popis leta 2002 v Sloveniji, ki v primerjavi s popisom iz leta 1991 izkazuje močno nazadovanje šte- vila pripadnikov italijanske in

- Diplomsko delo, Biotehniški center Naklo, Višja strokovna šola, Upravljanje podeželja in krajine.. Osredotočila sem se na golf